<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 RAL+RTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
E92EQ, G140GS, Y143YR, Q148QR, N155NH V151I S17N, V31I, V79VI, L101I, T124A, L234I  
>pt4| codons 1-288
FLDGIDKAQEEHEKYHNNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHIASGYIEAEVIPAQTGQETAYFILKLAGRWPVKTIHTDNGSN
FTSATVKAACWWAGIKQEFSIPRNPQSRGVIESMHKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED

References
Author Title Citation
Fransen, S HIV-1 mutations at positions 143, 148, and 155 of integrase define different genetic barriers to raltegravir resistance in vivo. Journal of Virology, 2012