<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
KRC4044 4044_0405 Korea 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, K14R, I15V, L19P, K20I, M36I, N37D, R41K, K43R, Q61H, L63P, H69K, L89M  
>4044_0405| codons 1-98
PQITLWQRPIVTVRVGGQPIEALLDTGADDTVLEEIDLPGKWRPKMIGGIGGFIKVRQYD
HIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLN

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39L, V60I, I135V, S162A, K173I, Q174K, D177E, I178M, T200A, Q207E, R211K, V245Q  
>4044_0405| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICLEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRIKNPEMVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKD

References
Author Title Citation
Chin, BS Inverse relationship between viral load and genotypic resistance mutations in Korean patients with primary HIV type 1 infections. ARHR, 2006