<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NBC-30 NBC-30Pr Thailand 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, K20R, E35D, M36I, R41K, L63S, H69K, L89M  
>NBC-30Pr| codons 1-99
PQITLWQRPLVTIKIEGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, V60I, K122E, D123S, T165I, K173T, Q174K, D177E, T200I, I202V, Q207A, R211S, V245E V118E, I135G
>NBC-30RT| codons 20-255
KVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSEPLDESFRKYTAFTIPSGNNET
PGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRTKNPEIVIYQYMDDLYVGSDLEIGQHR
IKVEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVN

References
Author Title Citation
Sirivichayakul, S HIV drug resistance transmission threshold survey in Bangkok, Thailand. Antivir Ther, 2008