<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NBC-20 NBC-20RT Thailand 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        R83K, D123E, I142T, K166R, G196E, L210F W252C
>NBC-20RT| codons 40-254
EMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAG
LKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAI
FQSSMTRILEPFRKQNPDIVIYQYMDDLYVGSDLEIEQHRTKIEELRQHLFRWGFTTPDK
KHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSCTV

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, M36I, N37D, R41K, I62V, L63P, I93L  
>NBC-20Pr| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QVPIEICGHKAIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Sirivichayakul, S HIV drug resistance transmission threshold survey in Bangkok, Thailand. Antivir Ther, 2008