<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NBC-11 NBC-11RT Thailand 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, E40D, K122E, D123S, K166R, K173I, Q174K, D177E, I178M, T200A, E203D, Q207A, R211S, K238R, V245E  
>NBC-11RT| codons 20-258
KVKQWPLTEEKIKALTEICTDMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRE
LNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNET
PGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRIKNPEMVIYQYMDDLYVGSDLEIGQHR
AKIDELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWTVQPIELPEKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, E35D, M36I, N37D, R41K, R57K, H69K, K70R, L89M  
>NBC-11Pr| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVKQYD
QILIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Sirivichayakul, S HIV drug resistance transmission threshold survey in Bangkok, Thailand. Antivir Ther, 2008