<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
NBC-5 NBC-5Pr Thailand 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, I13V, E35D, M36I, R41K, L63P, H69K, L89M  
>NBC-5Pr| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, V60I, K104R, K122E, I135T, I142V, E169D, T200E, K238I I202K
>NBC-5RT| codons 28-244
EEKIKALTEICTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDF
WEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGVRYQYN
VLPQGWKGSPAIFQSSMTKILDPFRKQNPDIVIYQYMDDLYVGSDLEIGQHREKKEELRQ
HLLRWGFTTPDKKHQKEPPFLWMGYELHPDIWTVQPI

References
Author Title Citation
Sirivichayakul, S HIV drug resistance transmission threshold survey in Bangkok, Thailand. Antivir Ther, 2008