<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BED-49 BED-49Pr Thailand 2005 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, I13V, K20R, E35D, M36I, R41K, R57K, L63T, H69K, L89M  
>BED-49Pr| codons 1-99
PQITLWQRPLVPVKIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QITIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, K43E, K102E, K122E, D123N, K173I, Q174K, D177E, V179T, I202V, Q207A, L210M, R211S, F214L, D237E, V245E I244D
>BED-49RT| codons 33-254
ALTEICKEMEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQL
GIPHPAGLKEKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQG
WKGSPAIFQSSMTKILEPFRIKNPEITIYQYMDDLYVGSDLEIGQHRTKVEELRAHLMSW
GLTTPDKKHQKEPPFLWMGYELHPEKWTVQPDELPEKDSWTV

References
Author Title Citation
Sirivichayakul, S HIV drug resistance transmission threshold survey in Bangkok, Thailand. Antivir Ther, 2008