<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BED-44 BED-44RT Thailand 2005 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39Q, K43E, K64R, K122E, D123S, I135T, K173I, Q174K, D177E, D192N, T200A, Q207A, L210F, R211S, V245E  
>BED-44RT| codons 37-251
ICQEMEEEGKISKIGPENPYNTPVFAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPH
PAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGS
PAIFQSSMTKILEPFRIKNPEIVIYQYMDDLYVGSNLEIGQHRAKIEELRAHLFSWGFTT
PDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, E35D, M36I, R41K, H69K, L89M  
>BED-44Pr| codons 1-96
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCT

References
Author Title Citation
Sirivichayakul, S HIV drug resistance transmission threshold survey in Bangkok, Thailand. Antivir Ther, 2008