<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
BED-32 BED-32Pr Thailand 2005 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    G16E, E35N, M36I, R41K, L63S, H69K, I72V, I93L  
>BED-32Pr| codons 1-99
PQITLWQRPLVTIKIEGQLKEALLDTGADDTVLENINLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKKAVGTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, T39K, V60I, K122E, D123S, T165I, K173I, Q174K, T200I, I202V, Q207A, R211S, V245E  
>BED-32RT| codons 25-256
PLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRT
QDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRY
QYNVLPQGWKGSPAIFQSSMIKILEPFRIKNPDIVIYQYMDDLYVGSDLEIGQHRIKVEE
LRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIELPEKDSWTVND

References
Author Title Citation
Sirivichayakul, S HIV drug resistance transmission threshold survey in Bangkok, Thailand. Antivir Ther, 2008