<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5353 CA13075 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 75

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67DN, K70R K219Q     K20R, V90I, A98S, K122E, D123N, I135AV, D177E, T200A, R211K, S251H, T286A, I293V, E297Q T253TA
>CA13075| codons 1-301
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEIQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSANNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDHWAVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTQEAE
L

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12A, I13V, I15IV, E35D, N37T, I62V, I64V  
>CA13239| codons 11-99
VAVKVGGQLKEALLDTGADDTVLEDMTLPGRWKPKMIGGIGGFIKVRQYDQVLVEICGHK
AIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009