<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1524 CA13062 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 17
2 AZT+DDI 13
3 None 122
4 3TC+AZT 35
5 3TC+D4T 78
6 3TC+D4T+SQV 20
7 3TC+D4T+RTV+SQV 71

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, V75M, M184V, L210W, T215Y F77L   E138K V35T, T39A, E44ED, V60I, V118I, K122E, I135T, S162X, H208HY, R211RK, A272P, K277R, T286A  
>CA13062| codons 1-291
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICAELEKDGKISKIGPENPYNTPI
FAIKKKNSDKWRKLMDLRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNKTPGIRYQYNVLPQGWKGSPAIFQXSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, V82A, I84V   L10I, I13V, E35D, M36I, N37D, L63P, A71V, T74S  
>CA13223| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEDIDLPGRWKPKMIVGIGGFIKVRQYD
QIPIEICGHKVIGSVLVGPTPANVIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005