<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
1607 1607 South Africa 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I I13V, K14R, N37S, R41K, L63S, I64V, V77I, I93V  
>1607| codons 1-99
PQITLWQRPLVTVRIGGQLKEALLDTGADDTVIEEMSLPGKWKPKMIGGIGGFIKVRQYD
QISVEICGHKAIGTVLIGPTPVNIIGRNLLTQVGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V8I, K49R, V106I, D123E, I135T, E169DN, I178L, T200A  
>1607| codons 1-205
PISPIETIPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILNPFRKQNPDLVI
YQYMDDLYVGSDLEIGQHRAKIEEL

References
Author Title Citation
Jacobs, GB Phylogenetic diversity and low level antiretroviral resistance mutations in HIV type 1 treatment-naive patients from Cape Town, South Africa. ARHR, 2008