<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
400196E 400196E Uganda 2007 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NVP 6

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, K20R, E35D, M36I, N37D, R41K, H69K, L89M  
>400196E| codons 1-99
PQITLWQRPLVTVRIGGQLREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN, V106VA   E6N, V35T, K49R, V60I, K64R, K122E, D123S, I135T, I142V, K173L, Q174K, D177E, V179I, T200A, Q207A, R211S, V245Q, D250E, A272P, E291D, I293V, P294T, E312D  
>400196E| codons 1-334
PISPINTVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISRIGPENPYNTPI
FAIRKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSATVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRLKNPEIII
YQYMDDLYVGSDLEIGQHRAKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIQLPEKESWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTDVVTLTEEAE
LELAENREILKDPVHGVYYDPSKDLIAEIQKQGQ

References
Author Title Citation
Church, JD Analysis of nevirapine (NVP) resistance in Ugandan infants who were HIV infected despite receiving single-dose (SD) NVP versus SD NVP plus daily NVP up to 6 weeks of age to prevent HIV vertical transmission. J Infect Dis, 2008