<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
389271-L 389271-L Uganda 2007 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 NVP 6

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    Y181C   V35T, T39S, V60I, D121Y, K122E, I142V, K166R, D177E, I178M, Q207E, R211K, V245K, D250E, A272P, K277R, L282C, T286A, I293V, E297A, D324E  
>389271-L| codons 1-334
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICSEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPEMVI
CQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKCLRGAKALTEVVPLTAEAE
LELAENREILKEPVHGVYYDPSKELIAEIQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I I13V, M36T, R41K, D60E, L63V, I64V, E65D  
>389271-L| codons 1-99
PQITLWQRPLVTVKIGGQLKEALLDTGADDTVIEETNLPGKWKPKMIGGIGGFIKVRQYE
QIVVDICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Church, JD Analysis of nevirapine (NVP) resistance in Ugandan infants who were HIV infected despite receiving single-dose (SD) NVP versus SD NVP plus daily NVP up to 6 weeks of age to prevent HIV vertical transmission. J Infect Dis, 2008