<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
377986-M 377986-M Uganda 2007 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NVP 6

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K103KN, Y188YC   V35T, V60I, K122E, D123S, I135T, P170S, K173A, Q174K, D177E, V179I, T200I, Q207E, V245K, D250E, T286A, E291D, I293V, P294A, E297K, A304E, E312D  
>377986-M| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILESFRAKNPEIII
YQYMDDLCVGSDLEIGQHRIKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTDVVALTKEAE
LELEENREILKDPVHGVYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16E, K20R, E35D, M36I, P39S, R41K, K45R, R57K, L63Q, H69K, L89M  
>377986-M| codons 1-99
PQITLWQRPLVTVKIEGQLREALLDTGADDTVLEDINLSGKWKPRMIGGIGGFIKVKQYD
QIQIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Church, JD Analysis of nevirapine (NVP) resistance in Ugandan infants who were HIV infected despite receiving single-dose (SD) NVP versus SD NVP plus daily NVP up to 6 weeks of age to prevent HIV vertical transmission. J Infect Dis, 2008