<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
9449 9449 Malawi 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215TFIS   K103N, G190A   T39E, S48T, K122E, D123G, I135T, K173A, Q174K, D177E, T200EK, Q207A, R211K, V245Q  
>9449| codons 38-247
CEEMEKEGKITKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRAKNPEIVIYQYVDDLYVASDLEIGQHRKKIEELRAHLLKWGFSTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, Q18L, L19T, K20R, E35D, M36I, N37D, R41K, H69K, A71T, I93L  
>9449| codons 4-99
TLWQRPLVTIKVGGLTREALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKKTIGTVLVGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Hosseinipour, MC The public health approach to identify antiretroviral therapy failure: High-level nucleoside reverse transcriptase inhibitor resistance among Malawians failing first-line antiretroviral therapy. AIDS, 2009