<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
9424 9424 Malawi 2007 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, K20R, E35D, M36L, R41K, L63P, H69K, V77I, L89M, I93L  
>9424| codons 4-99
TLWQRPLVSIKVGGQIREALLDTGADDTVLEDLNLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGKKAIGTVLIGPTPVNIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, K70KR, Q151M, M184I V75I, F77FL, F116Y Y181C   T39E, S48T, V60I, S68G, K122E, D123S, I132L, I135T, K173A, Q174K, D177E, I178M, T200A, E204D, R211K, H221Y, V245Q  
>9424| codons 38-247
CEEMEKEGKITKIGPENPYNTPIFAIKRKDGTRWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYYSVPLDESFRKYTAFTLPSTNNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRAKNPEMVICQYIDDLYVGSDLEIGQHRAKIEDLRQHLLKWGFTTP
DKKYQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Hosseinipour, MC The public health approach to identify antiretroviral therapy failure: High-level nucleoside reverse transcriptase inhibitor resistance among Malawians failing first-line antiretroviral therapy. AIDS, 2009