<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
9369 9369 Malawi 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q K101E, G190A A98G, P225H T39E, S48T, I94IL, K103R, K122E, D123N, K173T, Q174K, D177E, I195IM, T200A, Q207D, R211K, F214L, V245Q  
>9369| codons 38-247
CEEMEKEGKITKIGPENPYNTPVFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGLPHP
GGLEKRKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRTKNPEIVIYQYVDDLYVASDLEMGQHRAKIEELRDHLLKWGLFTP
DQKHQKEHPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12S, I15V, L19I, M36I, R41K, D60E, Q61E, H69K, L89M, I93L  
>9369| codons 4-99
TLWQRPLVSIKVGGQIKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYEEIL
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Hosseinipour, MC The public health approach to identify antiretroviral therapy failure: High-level nucleoside reverse transcriptase inhibitor resistance among Malawians failing first-line antiretroviral therapy. AIDS, 2009