<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5321 CA13033 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+RTV 148

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, L74I, M184V, T215F D67G, K219Q     K20R, K43KN, K64N, T69N, I142V, R143X, G196E, I202V, V245K, K277R, A288AS, I293V A129AG, T131TS, V261VL
>CA13033| codons 1-300
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELENEGKISKIGPENPYNTPV
FAINKKGSNRWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTGFSIPSINNETPGVXYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRTKVEELRQHLLRWGFFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLLGKLNWASQIYAGIKVRQLCKLLRGTKSLTEVVPLTEEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M K43T K20R, M36I, Q61E, I62V, L63P, A71V, I72K  
>CA13193| codons 1-99
PQITLWQRPLVTIKIGGQLREALLDTGADDTVLEEINLPGRWTPKMIGGIGGFVKVRQYD
EVPIEICGHKVKGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005