<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
9371 9371 Malawi 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, T69~, Q151M, M184V   Y181C, G190A   T39E, S48T, E53D, K122E, D123G, I132L, K173A, D177E, I195IV, G196T, T200A, Q207E, R211K, V245Q  
>9371| codons 38-247
CEEMEKEGKITKIGPDNPYNTPVFAIKRKDS~KWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEGFRKYTAFTLPSINNETPGIRYQYNVLPMGWKGSP
AIFQSSMTKILEPFRAQNPEIVICQYVDDLYVASDLEVTQHRAKIEELREHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, M36I, R41K, L63P, H69K, L89M, I93L  
>9371| codons 4-99
TLWQRPLVTIKVGGQLKEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Hosseinipour, MC The public health approach to identify antiretroviral therapy failure: High-level nucleoside reverse transcriptase inhibitor resistance among Malawians failing first-line antiretroviral therapy. AIDS, 2009