<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5306 CA13015 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 117
2 AZT+ 3TC 69
3 AZT+ 3TC+ IDV 17
4 D4T+ 3TC+ NFV 86
5 D4T+ DDI+ NVP 3

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       K20R, V35M, A98S, K122E, D123DN, I132IM, I135V, V148X, I195T, T200A, F214L  
>CA13015| codons 1-251
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTMPSVNNETPGIRYQYNXLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLETGQHRAKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12V, N37ST, I64V  
>CA13175| codons 1-99
PQITLWQRPLVVIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILVEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001