<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
xs.2901 06HBxs.2901 China 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179D K102R, I135V, I142V, S162C, T200A, N255K, K277R, Q278E, V292I, K311R, D324E, Q334L Q85H
>06HBxs.2901| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTHDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIDI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVKDIQKLVGKLNWASQIYAGIKVRELCKLLRGTKALTEIIPLTEEAE
LELAENREILREPVHGVYYDPSKELIAEIQKQGLG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
N88S   R41K, L63P, I72E, V77I I93P
>06HBxs.2901| codons 8-99
RPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYDQIPIEIC
GHKAEGTVLIGPTPVNIIGRSLLTQPGCTLNF

References
Author Title Citation
Luo, M Prevalence of drug-resistant HIV-1 in rural areas of Hubei province in the People's Republic of China. JAIDS, 2009