<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
wh.1890 06HBwh.1890 China 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, K14R, E35D, M36I, R41K, R57K, H69K, L89M  
>06HBwh.1890| codons 8-99
RPVVTVRIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYDQILIEIC
GKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E6D, K32E, V35T, T39K, K43E, V60I, R83G, K103R, K122E, D123S, I135V, K173I, Q174K, D177E, T200I, Q207A, R211S, K238R, V245E, A272G, T286A, E291D, V292I, I293V, E312T, I329V, Q332R, Q334L  
>06HBwh.1890| codons 1-335
PISPIDTVPVKLKPGMDGPKVKQWPLTEEKIEALTEICKEMEEEGKISKIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKGTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPEIVI
YQYMDDLYVGSDLEIGQHRIKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYGGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKTPVHGVYYDPSKDLIAEVQKRGLG

References
Author Title Citation
Luo, M Prevalence of drug-resistant HIV-1 in rural areas of Hubei province in the People's Republic of China. JAIDS, 2009