<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
xs.1386 05HBxs.1386 China 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, D67N A62V, V75T V106M, G190A V179D K101Q, I135V, S162C, T200A, L210F, A272P, K277R, Q278E, L283I, Q334L D113G, M164V
>05HBxs.1386| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKRKNSTKWRKLTDFRELNKRTQDFWEVQLGIPHPAGLQKKKSMTVLDVGGAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQCSVTKILEPFRKQNPDIDI
YQYMDDLYVASDLEIGQHRAKIEELRQHLFRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRELCKLIRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    R41K, K43R, L63P, A71V, I72E, V77I, I93L  
>05HBxs.1386| codons 8-99
RPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWRPKMIGGIGGFIKVRQYDQIPIEIC
GHKVEGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Luo, M Prevalence of drug-resistant HIV-1 in rural areas of Hubei province in the People's Republic of China. JAIDS, 2009