Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA5294 | CA13003 | U.S. | 1999 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | 3TC+D4T | 7 |
| 2 | NRTI | 106 |
| 3 | 3TC+D4T+IDV | 52 |
| 4 | IDV | 2 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| I54V, V82A | L24I | Q7D, L10I, I15V, L19I, E35D, N37T, R41K, L63P, A71V |
| >CA13003| codons 1-99 PQITLWDRPIVTIKVGGQIKEALIDTGADDTVLEDMTLPGKWKPKMIGGIGGFVKVRQYD QIPIEICGHKVIGTVLVGPTPANIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Gonzales, MJ | HIV-1 reverse transcriptase and protease subtypes: classification, amino acid mutation patterns, and prevalence in a Northern California clinic-based population. | J Infect Dis, 2001 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |