<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
sz.658 04HBsz.658 China 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
      V179E K11R, I135V, S162N, T200A, L210F, R211K, K277R, Q278E, L283I, P294S, Q334L  
>04HBsz.658| codons 1-335
PISPIETVPVRLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQNSMTKILEPFRKQNPDIEI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLFKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRELCKLIRGTKALTEVISLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGLG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L63P, I72V, V77I, I93L  
>04HBsz.658| codons 8-99
RPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIPIEIC
GHKAVGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Luo, M Prevalence of drug-resistant HIV-1 in rural areas of Hubei province in the People's Republic of China. JAIDS, 2009