<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5278 CA12986 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 53
2 DDI 75
3 DDC 113
4 3TC+DDC+IDV 185

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A L24I L10IV, I13V, K14KR, I15IL, L63P  
>CA12986| codons 10-99
VVTVRLGGQLKEALIDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGH
KAIGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
Q151KM, M184V A62V     K20R, S68ST, F87FL, K122E, I135T, S162CW, F214L G155GR, I159IL
>CA12941| codons 1-243
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKDTTKWRKLVDFRELNKRTQDLWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPMGWKRSPALFQWSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQP

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001