<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5277 CA12985 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI NA
2 D4T 73
3 3TC+IDV 78
4 3TC+IDV+NVP 69
5 ABC+NFV 46

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A L24I, K43T L10I, R41K, K55R, I62V, L63P, A71V, I72M, T74A, V77I, I93L  
>CA12985| codons 1-99
PQITLWQRPIVTIKIGGQLKEALIDTGADDTVLEEMNLPGKWTPKIIGGIGGFVRVRQYD
QVPIEICGHKVMGAVLIGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184V   K103N   E28A, V35T, T39A, E40D, I47IF, K122P, K166I, Q174R, I178M, G196E, T200A, Q207E, R211K, V245E, A272P  
>CA12940| codons 1-276
PISPIETVPVKLKPGMDGPKVKQWPLTAEKIKALTEICADMEKEGKFSKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTIILEPFRKRNPDMVI
YQYVDDLYVGSDLEIEQHRAKIEELREHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYPGIKV

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005