<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
78 TCHAD-78 Chad 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, T12K, I13V, K14R, G16E, L19P, K20V, E35D, M36I, R41S, C67Y, H69K, L89M  
>TCHAD-78| codons 1-99
PQITLWQRPIVKVRIEGQPVEALLDTGADDTVLEDINLPGSWKPKMIGGIGGFIKVRQYD
QILIEIYGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K122E, D123N, I135V, S162C, K173T, Q174R, D177E, I178L, T200A, Q207N, R211K  
>TCHAD-78| codons 41-240
MEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIF
QCSMTKILEPFRTRNPELVIYQYMDDLYVGSDLEIGQHRAKIEELRNHLLKWGFTTPDKK
HQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Koyalta, D High frequency of antiretroviral drug resistance among HIV-infected adults receiving first-line highly active antiretroviral therapy in N'Djamena, Chad. Clin Infect Dis, 2009