<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1175 CA12975 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+ NFV+ 3TC 39
2 AZT+ DDC+ IDV 14
3 None 4
4 AZT+ DDC 4
5 DDC+ RTV+ SQV+ AZT 74

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    E35D, N37D, L63P, A71T  
>CA12975| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKTIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35I, K102R, D121H, K122E, S162C, E169D, D177E, T200A, Q207QP, R211K, K263KR, A272P, K281R, I293V, E297K E138EV, T253TS
>CA12926| codons 1-301
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAYFSVPL
HEDFRKYTAFTIPSINNVTPGIRYQYNVLPQGWKGSPAIFQCSMTKILDPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRPHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWSVNDIQKLVGRLNWASQIYPGIKVKQLCRLLRGTKALTEVVPLTKEAE
L

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005