<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
28 TCHAD-28 Chad 2005 HIV1 F Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V   K103N V108I K82R, D121H, K122E, S162C, K173S, Q174K, D177E, I178L, T200A, Q207D, R211K, L228Q  
>TCHAD-28| codons 41-240
MEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNRRTQDFWEVQLGIPHPAGL
KKNKSVTILDVGDAYFSVPLHEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIF
QCSMTKILEPFRSKNPELVIYQYVDDLYVGSDLEIGQHRAKIEELRDHLLKWGFTTPDKK
HQKEPPFQWMGYELHPDKWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, K20R, E35D, M36I, R41K, R57K, L63A, T74S, L89M  
>TCHAD-28| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIAIEICGHKAIGSVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Koyalta, D High frequency of antiretroviral drug resistance among HIV-infected adults receiving first-line highly active antiretroviral therapy in N'Djamena, Chad. Clin Infect Dis, 2009