<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
8 TCHAD-8 Chad 2005 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 26

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V K219E     V60I, V106I, V118I, T139S, T165I, D177E, I178L, K201R, E204K, Q207E, R211K, F214L  
>TCHAD-8| codons 41-240
MEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSITVLDVGDAYFSIPLDKDFRKYTAFTIPSINNESPGIRYQYNVLPQGWKGSPAIF
QSSMIKILEPFRKQNPELVIYQYVDDLYVGSDLEIGQHRTRIEKLREHLLKWGLTTPDEK
HQKEPPFLWMGYELHPDKWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A   L10I, T12S, I15V, L19I, E35D, M36I, R41K, L63P, K70E, A71T, I93L  
>TCHAD-8| codons 1-99
PQITLWQRPIVSIKVGGQIKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHETIGTVLVGPTPANIIGRNLLTQLGCTLNF

References
Author Title Citation
Koyalta, D High frequency of antiretroviral drug resistance among HIV-infected adults receiving first-line highly active antiretroviral therapy in N'Djamena, Chad. Clin Infect Dis, 2009