<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
4 TCHAD-4 Chad 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+NVP 26

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, L19V, K20I, E35D, M36I, R41K, K43R, H69K, L89M  
>TCHAD-4| codons 1-99
PQITLWQRPLVTVRIEGQVIEALLDTGADDTVLEDINLPGKWRPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E53D, D123E, I135V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207D  
>TCHAD-4| codons 41-240
MEKEGKISKIGPDNPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGL
KKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIF
QASMTKILEPFRTKNPEMVIYQYMDDLYVGSDLEIGQHRAKIEELRDHLLRWGFTTPDKK
HQKEPPFLWMGYELHPDKWT

References
Author Title Citation
Koyalta, D High frequency of antiretroviral drug resistance among HIV-infected adults receiving first-line highly active antiretroviral therapy in N'Djamena, Chad. Clin Infect Dis, 2009