<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA790 CA12970 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 365
2 AZT+DDC 22
3 3TC+AZT 31
4 3TC+AZT+IDV 9
5 3TC+D4T+IDV 60
6 D4T+DDI+RTV+SQV 58
7 D4T+DDI+EFV+RTV+SQV 28
8 D4T+DDI+EFV+SQV 2

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I L24I, G73S L10I, I13LV, L63P, I66V, A71T, I72V, I93L  
>CA12970| codons 1-99
PQITLWQRPIVTLKIGGQLKEALIDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYD
QIPIEVCGHKTVSTVLVGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y K219Q   A98AG V35I, T39A, D123E, I135T, V179I, G190X, D218E, E248D, D250E S251L
>CA12921| codons 1-251
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICAELEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
YQYMDDLYVXSDLEIGQHRTKIEELRQHLLRWGFYTPEQKHQKEPPFLWMGYELHPDKWT
VQPIVLPDKEL

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005