<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI 4
2 NNRTI+NRTI+PI+RAL 50

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
N155H V151I, G163R S17N, V31I, T112V, T124N, T125A, V126L, S230N, D256E  
>4951| codons 3-268
DGIDKAQEEHEKYHNNWRAMASDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQ
LDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSNFT
SNALKAACWWAGIKQEFGIPYNPQSQGVIESMHKELKKIIRQVRDQAEHLKTAVQMAVFI
HNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDNRDPLWKGPAKLL
WKGEGAVVIQDNSEIKVVPRRKAKII

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009