<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI 280
2 NNRTI+NRTI+PI+RAL 34

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
N155H   K14R, R20K, V31I, M50I, S57G, E96DN, L101I, T112V, S119SR, T124G, T125A, G134NS, I135IV, V201I, T206S, L234I  
>4783| codons 8-258
AQEEHERYHSNWKAMASDFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCGPGIWQLDCTH
LEGKIILVAVHVASGYIEAEVIPAETGQNTAYFILKLAGRWPVKVIHTDNGRNFTSGAVK
AACWWASVKQEFGIPYNPQSQGVVESMHKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKR
KGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAKLLWKGEG
AVVIQDNSDIK

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009