<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
Pt01 3-Koeln Germany 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI 29
2 NNRTI+NRTI+PI+RAL 31

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
G140GA, Q148QR   S119G, T122I, T125A, V201I, K215N  
>3-Koeln| codons 38-266
ASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQET
AYFLLKLAGRWPVKTIHTDNGGNFISTAVKAACWWAGIKQEFAIPYNPQSRGVVESMNKE
LKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQNQI
TKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAK

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009