<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
53-E 53-E Germany 2005 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K34KR, S39SC, L101I, T112V, T124N, T125A, G134N, K136T, V201I, T206S, Y227F, L234V, S255N, D256E  
>53-E| codons 25-266
DFNLPPVVAREIVACCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKIILVAVHVASGYI
EAEVIPAETGQETAYFILKLAGRWPVKVIHTDNGSNFTSNAVKAACWWANITQEFGIPYN
PQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIIDII
ASDIQTKELQKQITKIQNFRVYFRDSRDPVWKGPAKLLWKGEGAVVIQDNNEIKVVPRRK
AK

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009