<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
52-E 52-E Germany 2005 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    Y99H, L101V, T112V, S119P, T124A, T125A, G134D, I135V, F181L, V201I, T206S, I208L, T218I, L234I, D256E V31VA, H114HR
>52-E| codons 24-266
SDFNLPPAVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKIILVAVHVASGY
IEAEVIPAETGQETAHFVLKLAGRWPVKVIRTDNGPNFTSAAVKAACWWADVKQEFGIPY
NPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVLIHNFKRKGGIGGYSAGERIIDI
IASDLQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAKLLWKGEGAVVIQDNSEIKVVPRR
KAK

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009