<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5296 CA12963 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDI 100
2 DDI+IDV 18
3 3TC+D4T+IDV 17
4 DDI+IDV 57
5 None 31
6 3TC+DDI+NVP 39
7 3TC+D4T+NFV 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V   Y181C V179D K122E, G196E, T200A, R211RK L234LH
>CA12963| codons 1-253
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIDI
CQYMDDLYVGSDLEIEQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWT

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    N37S, R41K, L63P, V77I, I93L  
>CA13006| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005