<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
60-E 60-E Germany 2006 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K34R, I60IM, I72V, I84M, T112V, I113V, S119P, T124A, T125A, I182IV, V201I, T206S, I208L, K211Q, L234I  
>60-E| codons 25-248
DFNLPPVVAREIVASCDKCQLKGEAMHGQVDCSPGMWQLDCTHLEGKVILVAVHVASGYM
EAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGPNFTSAAVKAACWWAGIKQEFGIPYN
PQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFVHNFKRKGGIGGYSAGERIIDII
ASDLQTQELQKQITKIQNFRVYYRDSRDPIWKGPAKLLWKGEGA

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009