<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5289 CA12955 U.S. 1999 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+NFV 35
2 D4T+DDI+NVP 39
3 ABC+RTV+SQV 29

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T215Y   Y181C   S3X, K20R, V21I, E44D, A98S, I135T, K154KE, K166R, Q197E, R211K, H221HY, K277R, Q278H, I293V  
>CA12955| codons 1-298
PIXPIETVPVKLKPGMDGPRIKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWEGSPAIFQSSMTRILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGEHRTKIEELRQHLLKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLRGTKALTEVVPLTEE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I84IV, L90M K43T L10V, I13V, K14R, K20KT, E35D, M36I, I62V, L63P, I64V, T74S  
>CA12992| codons 1-99
PQITLWQRPVVTVRIGGQLTEALLDTGADDTVLEDINLPGRWTPKMIGGIGGFIKVRQYD
QVPVEICGHKAIGSVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005