<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
57-E 57-E Germany 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, S24N, V31I, M50I, A91E, L101I, T112V, S119R, T122I, T124N, T125A, G134N, K136T, V165I, V201I, T206S, L234I  
>57-E| codons 5-271
IDKAQEDHERYHSNWRAMANDFNLPPIVAKEIVASCDKCQLKGEAIHGQVDCSPGIWQLD
CTHLEGKIILVAVHVASGYIEAEVIPEETGQETAYFILKLAGRWPVKVIHTDNGRNFISN
AVKAACWWANITQEFGIPYNPQSQGVVESMNKELKKIIGQIRDQAEHLKTAVQMAVFIHN
FKRKGGIGGYSAGERIIDIIASDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAKLLWK
GEGAVVIQDNSDIKVVPRRKAKIIRDY

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009