<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
55-E 55-E Germany 2006 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    S24H, V31I, I72V, T112V, T124A, T125A, G134N, I135V, K136T, V201I, T206S, D207E, L234I, D256DE  
>55-E| codons 23-270
AHDFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASG
YIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSNFTSAAVKAACWWANVTQEFGIP
YNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIID
IIASEIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAKLLWKGEGAVVIQDNSEIKVVPR
RKAKIIRD

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009