<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
27-E 27-E Germany 2005 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    V31I, S57G, I72V, T112V, T124A, T125A, G134N, I135V, K136T, V201I, T206S, T218TI, L234I  
>27-E| codons 26-248
FNLPPIVAKEIVASCDKCQLKGEAMHGQVDCGPGIWQLDCTHLEGKVILVAVHVASGYIE
AEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSNFTSAAVKAACWWANVTQEFGIPYNP
QSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIIDIIA
SDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAKLLWKGEGA

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009