<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
23-E 23-E Germany 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, M22MR, D25E, V31I, I60M, I72IV, T112V, T124A, T125A, V126M, I135V, K136Q, E157Q, K160Q, I162IV, S195ST, V201I, T206S, T218I, L234I R20RG
>23-E| codons 9-258
QEDHERYHSNWGARASEFNLPPIVAKEIVASCDKCQLKGEAMHGQVDCSPGMWQLDCTHL
EGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVIHTDNGSNFTSAAMKA
ACWWAGVQQEFGIPYNPQSQGVVESMNKQLKQIVGQVRDQAEHLKTAVQMAVFIHNFKRK
GGIGGYTAGERIIDIIASDIQTKELQKQIIKIQNFRVYYRDSRDPIWKGPAKLLWKGEGA
VVIQDNSDIK

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009