<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
22-E 22-E Germany 2006 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, K14R, A21T, A23V, V31I, S39SN, I60M, I72V, T112V, I113V, T124A, T125A, V126F, G134N, I135V, K136Q, V165I, D167E, V201I, L234I  
>22-E| codons 8-267
AQEDHERYHSNWRTMVSDFNLPPIVAKEIVANCDKCQLKGEAMHGQVDCSPGMWQLDCTH
LEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKVVHTDNGSNFTSAAFK
AACWWANVQQEFGIPYNPQSQGVVESMNKELKKIIGQIREQAEHLKTAVQMAVFIHNFKR
KGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPIWKGPAKLLWKGEG
AVVIQDNSDIKVVPRRKAKI

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009