<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
43-E 43-E Germany 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    E11D, V31I, M50T, L101I, G193E, I203M  
>43-E| codons 10-267
EDHEKYHSNWRAMASDFNLPPIVAKEIVASCDKCQLKGEATHGQVDCSPGIWQLDCTHLE
GKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSNFTSTTVKAA
CWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKG
GIGEYSAGERIVDMIATDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAV
VIQDNSDIKVVPRRKAKI

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009