<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
39-E 39-E Germany 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    L45V, L101I, S119P, T122I, T124TA, G163E, V201I, D256E  
>39-E| codons 26-263
FNLPPVVAKEIVASCDKCQVKGEAMHGQVDCSPGIWQLDCTHLEGKIILVAVHVASGYIE
AEVIPAETGQETAYFILKLAGRWPVKTIHTDNGPNFISATVKAACWWAGIKQEFGIPYNP
QSQGVVESMNKELKKIIEQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIIDIIA
TDIQTKELQKQITKIQNFRVYYRDSRDPLWKGPAKLLWKGEGAVVIQDNSEIKVVPRR

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009