<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
9-E 9-E Germany 2005 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 NNRTI+NRTI+PI NA

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
    K14R, S17SN, A23V, L45Q, L101I, T122I, T124A, G163E, K173R, V201I, L234LIRS, S255K, R269G F1I
>9-E| codons 1-269
ILDGIDKAQEEHERYHNNWRAMVSDFNLPPVVAKEIVASCDKCQQKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQETAYFILKLAGRWPVKTIHTDNGSN
FISATVKAACWWAGIKQEFGIPYNPQSQGVVESMNKELKKIIEQVRDQAEHLRTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQITKIQNFRVYYRDSRDPSWKGPAK
LLWKGEGAVVIQDNKDIKVVPRRKAKIIG

References
Author Title Citation
Sichtig, N Evolution of raltegravir resistance during therapy. J Antimicrob Chemother, 2009